PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta008892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NF-YC
Protein Properties Length: 281aa    MW: 31295.3 Da    PI: 5.6567
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-51404PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC57.82.5e-186861898
      NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
               ++++P +rikki++aded+ +i+  +P l+sk+ elf+ +l  r++  + +   +t+  s ++++v r ++fdfl +iv +
  Pta008892  6 DTRFPASRIKKIMQADEDIGKIAQAVPLLVSKSLELFLQDLCDRTYEITLQRGTKTVSASHLKQCVHRYNVFDFLREIVNK 86
               5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.9E-26272IPR009072Histone-fold
SuperFamilySSF471132.01E-20389IPR009072Histone-fold
PfamPF008081.5E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MKKKLDTRFP ASRIKKIMQA DEDIGKIAQA VPLLVSKSLE LFLQDLCDRT YEITLQRGTK  60
TVSASHLKQC VHRYNVFDFL REIVNKVPDM GGSDAATGEE RNGGRRRKAQ EGDENESDED  120
EVKRAXDGND LIKGAHHGSG RGRGRRGRGR GSRGGSSGRN GITVEKFEDE DLDLSSEHSE  180
KQEKVSEIFT DVNTETRETK VAVNLVSTPV VRDFDLNMEL DESGVVASMP TQPAVKLEHH  240
PSDAANVPVI VKEADEFPSD VPIVQHPIKQ EEQYPNWSHS X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A9e-23271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.135590.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6R6F95e-66A0A0D6R6F9_ARACU; Uncharacterized protein